PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G0506
Common NameSPL13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 352aa    MW: 39662.5 Da    PI: 9.6437
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G0506genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP121.15e-38102178177
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  +C v+gC+++ls++k+yhrr kvC+ hska++v+++g+++rfCqqCsrfh+l+efDe+krsCr+rL++hn+rrrk+q
  Gh_D07G0506 102 RCLVDGCNSELSKCKDYHRRNKVCQLHSKAAQVFINGKKKRFCQQCSRFHSLEEFDERKRSCRKRLEGHNRRRRKPQ 178
                  6**************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.1E-3095164IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.462100177IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.32E-35101179IPR004333Transcription factor, SBP-box
PfamPF031104.3E-29103176IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MNNPFALNTF QRDKQLDWNL SNSNSCMDWN LRGATTWNLP KIVEEPSFDT INGSSNGDFS  60
VDLKLSPLNK WKKPPLPMAS SSSSSSKRAG ASNNNGSRQQ VRCLVDGCNS ELSKCKDYHR  120
RNKVCQLHSK AAQVFINGKK KRFCQQCSRF HSLEEFDERK RSCRKRLEGH NRRRRKPQSM  180
YPLSLMRPGT YFSDYQGTES FPFASLNIPT WPGVNTQEPI VKKDTLQNRT PPTCQSFRTA  240
PEGNGGSSSH NVSCDRLVSW FRDADYALSL LSSVRTQPSS GIGSSNLVQS HSFALVHPSR  300
LSVANPVVEP MGSLAVANDR DDRVHCPEMV HMDCGECSKT QDPHTLPFHR KY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-2890176184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1158175RKRSCRKRLEGHNRRRRK
2158176RKRSCRKRLEGHNRRRRKP
3159176KRSCRKRLEGHNRRRRKP
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6223210.0KJ622321.1 Gossypium hirsutum SQUAMOSA promoter binding-like transcription factor (SPL13) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012467788.10.0PREDICTED: squamosa promoter-binding-like protein 13A
SwissprotB9DI203e-49SP13A_ARATH; Squamosa promoter-binding-like protein 13A
SwissprotP0DI113e-49SP13B_ARATH; Squamosa promoter-binding-like protein 13B
TrEMBLA0A088DL550.0A0A088DL55_G
STRINGPOPTR_0015s11100.12e-75(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2471034
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.13e-47SBP family protein
Publications ? help Back to Top
  1. Zhang X, et al.
    Genomic organization, differential expression, and functional analysis of the SPL gene family in Gossypium hirsutum.
    Mol. Genet. Genomics, 2015. 290(1): p. 115-26
    [PMID:25159110]